PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI10G19060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 658aa    MW: 67797 Da    PI: 6.481
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI10G19060.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS303.35.8e-932966572374
             GRAS   2 velLlecAeavssgdlelaqalLarlsel...aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                      ve+L e+A+  ++gd+  a+++Larl+ +   a  +g+p+ R a+yf+eAL+  l+     + +a +ps++++++++ +l a+k+fsevsP+l+
  ORUFI10G19060.1 296 VEQLAEAAKLAEAGDAFGAREILARLNYRlpaAPTAGTPLLRSAFYFKEALRLALSP----TGDAPAPSASTPYDVVVKLGAYKAFSEVSPVLQ 385
                      789*************************999555566******************99....999999*************************** PP

             GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                      f+hlt+ qa+l+++ g+ ++H++Dfdi++G QW++L+q+La+  ++++ l++T+++sp+s++  el+ ++e+L+ fA+elgv f+f+v+   ++
  ORUFI10G19060.1 386 FAHLTCVQAVLDELGGAGCIHVLDFDIGMGEQWASLMQELAQ-LRPAAALKVTALVSPASHHPLELQLIHENLSGFAAELGVFFHFTVF---NI 475
                      *****************************************7.46788****************************************9...77 PP

             GRAS 187 edleleeL.rvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                      ++l++ eL ++ + g+a+aV+l +   +          ++++vL+lvk+l +kvvv v++ +d+++ +F+++++++++  ++l++s++a  +++
  ORUFI10G19060.1 476 DTLDPAELlAIATaGDAVAVHLPVGPAHAA--------KTPAVLRLVKRLGAKVVVSVDRGCDRSDLPFAAHLFHSFHSAVYLLESIDAV-GTD 560
                      77777665366668**********999997........5788*********************************************998.788 PP

             GRAS 279 seerikvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                       ++++k+Er l++++i+++v +++++ + +++     Wr+++ +aGF pv+ +++a++qa++ll+kv+++g+rve++ gsl+l+W++ +LvsvS
  ORUFI10G19060.1 561 PDTASKIERYLIHPAIEQCVVASHRAaSAMDKAPPPPWRAAFAAAGFAPVQATTFAESQAESLLSKVHVRGFRVEKRAGSLCLYWQRGELVSVS 654
                      8*****************9888777658999999************************************************************ PP

             GRAS 372 aWr 374
                      aWr
  ORUFI10G19060.1 655 AWR 657
                      **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.909269637IPR005202Transcription factor GRAS
PfamPF035142.0E-90296657IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    Send to blast
MPFGGSAREG HAGTLLQHHL IHGVGLAAAG KLVSSSSAAA AAAGAGGFWE PRSVLDHRHS  60
PSPSPPTSAS TLSSPLADVA ALAGANAKNV SVSPPPPGWG TGGGGGGGEE VVAAKEEWVH  120
QLTPLDMGLG AGEGWDAAGN VLSDAAAAAT SGMAPDNTFL RWIIGGGEDA SAAMAGVMDP  180
PVLELDHGGG GGAAPAAFGP FAPPPAMEDT KPVVPFAAGH PPPNFLLQHH HHHPQPHAAF  240
FGAHHPSFDA APPPSKRHHP MAAAPAPKLP PFPAGGFVPA LKPKAEAAND EAAAAVEQLA  300
EAAKLAEAGD AFGAREILAR LNYRLPAAPT AGTPLLRSAF YFKEALRLAL SPTGDAPAPS  360
ASTPYDVVVK LGAYKAFSEV SPVLQFAHLT CVQAVLDELG GAGCIHVLDF DIGMGEQWAS  420
LMQELAQLRP AAALKVTALV SPASHHPLEL QLIHENLSGF AAELGVFFHF TVFNIDTLDP  480
AELLAIATAG DAVAVHLPVG PAHAAKTPAV LRLVKRLGAK VVVSVDRGCD RSDLPFAAHL  540
FHSFHSAVYL LESIDAVGTD PDTASKIERY LIHPAIEQCV VASHRAASAM DKAPPPPWRA  600
AFAAAGFAPV QATTFAESQA ESLLSKVHVR GFRVEKRAGS LCLYWQRGEL VSVSAWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-2532765732375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983723.10.0PREDICTED: scarecrow-like protein 6 isoform X1
TrEMBLA0A0E0R2920.0A0A0E0R292_ORYRU; Uncharacterized protein
STRINGMLOC_72502.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67232954
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.14e-80GRAS family protein